AKR1B1,ALDR1,AR
  • AKR1B1,ALDR1,AR

Anti-AKR1B1 Antibody 100ul

Ref: AN-HPA026425-100ul
Anti-AKR1B1

Información del producto

Polyclonal Antibody against Human AKR1B1, Gene description: aldo-keto reductase family 1, member B1 (aldose reductase), Alternative Gene Names: ALDR1, AR, Validated applications: ICC, IHC, Uniprot ID: P15121, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AKR1B1
Gene Description aldo-keto reductase family 1, member B1 (aldose reductase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Immunogen CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALDR1, AR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P15121
HTS Code 3002150000
Gene ID 231
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AKR1B1 Antibody 100ul

Anti-AKR1B1 Antibody 100ul