CDCA2,PPP1R81
  • CDCA2,PPP1R81

Anti-CDCA2 Antibody 25ul

Ref: AN-HPA026293-25ul
Anti-CDCA2

Información del producto

Polyclonal Antibody against Human CDCA2, Gene description: cell division cycle associated 2, Alternative Gene Names: PPP1R81, Repo-Man, Validated applications: ICC, IHC, Uniprot ID: Q69YH5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDCA2
Gene Description cell division cycle associated 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS
Immunogen VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PPP1R81, Repo-Man
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q69YH5
HTS Code 3002150000
Gene ID 157313
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDCA2 Antibody 25ul

Anti-CDCA2 Antibody 25ul