UTP6,C17orf40,HCA66
  • UTP6,C17orf40,HCA66

Anti-UTP6 Antibody 25ul

Ref: AN-HPA025936-25ul
Anti-UTP6

Información del producto

Polyclonal Antibody against Human UTP6, Gene description: UTP6, small subunit (SSU) processome component, homolog (yeast), Alternative Gene Names: C17orf40, HCA66, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NYH9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UTP6
Gene Description UTP6, small subunit (SSU) processome component, homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
Immunogen ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C17orf40, HCA66
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYH9
HTS Code 3002150000
Gene ID 55813
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UTP6 Antibody 25ul

Anti-UTP6 Antibody 25ul