RSU1,FLJ31034,RSP-1
  • RSU1,FLJ31034,RSP-1

Anti-RSU1 Antibody 100ul

Ref: AN-HPA025927-100ul
Anti-RSU1

Información del producto

Polyclonal Antibody against Human RSU1, Gene description: Ras suppressor protein 1, Alternative Gene Names: FLJ31034, RSP-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q15404, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RSU1
Gene Description Ras suppressor protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence DLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKN
Immunogen DLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ31034, RSP-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15404
HTS Code 3002150000
Gene ID 6251
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RSU1 Antibody 100ul

Anti-RSU1 Antibody 100ul