USP34,KIAA0570
  • USP34,KIAA0570

Anti-USP34 Antibody 25ul

Ref: AN-HPA025815-25ul
Anti-USP34

Información del producto

Polyclonal Antibody against Human USP34, Gene description: ubiquitin specific peptidase 34, Alternative Gene Names: KIAA0570, KIAA0729, Validated applications: IHC, Uniprot ID: Q70CQ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name USP34
Gene Description ubiquitin specific peptidase 34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLI
Immunogen QHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0570, KIAA0729
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q70CQ2
HTS Code 3002150000
Gene ID 9736
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-USP34 Antibody 25ul

Anti-USP34 Antibody 25ul