FH,fumarase
  • FH,fumarase

Anti-FH Antibody 100ul

Ref: AN-HPA025770-100ul
Anti-FH

Información del producto

Polyclonal Antibody against Human FH, Gene description: fumarate hydratase, Alternative Gene Names: fumarase, Validated applications: ICC, IHC, WB, Uniprot ID: P07954, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FH
Gene Description fumarate hydratase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
Immunogen DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names fumarase
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P07954
HTS Code 3002150000
Gene ID 2271
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FH Antibody 100ul

Anti-FH Antibody 100ul