BLZF1,JEM-1
  • BLZF1,JEM-1

Anti-BLZF1 Antibody 100ul

Ref: AN-HPA025703-100ul
Anti-BLZF1

Información del producto

Polyclonal Antibody against Human BLZF1, Gene description: basic leucine zipper nuclear factor 1, Alternative Gene Names: JEM-1, Validated applications: IHC, WB, Uniprot ID: Q9H2G9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BLZF1
Gene Description basic leucine zipper nuclear factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE
Immunogen KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names JEM-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2G9
HTS Code 3002150000
Gene ID 8548
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BLZF1 Antibody 100ul

Anti-BLZF1 Antibody 100ul