MICALL2,FLJ23471
  • MICALL2,FLJ23471

Anti-MICALL2 Antibody 25ul

Ref: AN-HPA025695-25ul
Anti-MICALL2

Información del producto

Polyclonal Antibody against Human MICALL2, Gene description: MICAL-like 2, Alternative Gene Names: FLJ23471, JRAB, MGC46023, MICAL-L2, Validated applications: IHC, Uniprot ID: Q8IY33, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MICALL2
Gene Description MICAL-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL
Immunogen DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23471, JRAB, MGC46023, MICAL-L2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IY33
HTS Code 3002150000
Gene ID 79778
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MICALL2 Antibody 25ul

Anti-MICALL2 Antibody 25ul