FBLIM1,CAL,FBLP-1
  • FBLIM1,CAL,FBLP-1

Anti-FBLIM1 Antibody 25ul

Ref: AN-HPA025287-25ul
Anti-FBLIM1

Información del producto

Polyclonal Antibody against Human FBLIM1, Gene description: filamin binding LIM protein 1, Alternative Gene Names: CAL, FBLP-1, migfilin, Validated applications: IHC, WB, Uniprot ID: Q8WUP2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FBLIM1
Gene Description filamin binding LIM protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHV
Immunogen CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAL, FBLP-1, migfilin
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUP2
HTS Code 3002150000
Gene ID 54751
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FBLIM1 Antibody 25ul

Anti-FBLIM1 Antibody 25ul