DFFA,DFF-45,DFF1
  • DFFA,DFF-45,DFF1

Anti-DFFA Antibody 25ul

Ref: AN-HPA025230-25ul
Anti-DFFA

Información del producto

Polyclonal Antibody against Human DFFA, Gene description: DNA fragmentation factor, 45kDa, alpha polypeptide, Alternative Gene Names: DFF-45, DFF1, DFF45, ICAD, Validated applications: IHC, WB, Uniprot ID: O00273, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DFFA
Gene Description DNA fragmentation factor, 45kDa, alpha polypeptide
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCS
Immunogen TKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFF-45, DFF1, DFF45, ICAD
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00273
HTS Code 3002150000
Gene ID 1676
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DFFA Antibody 25ul

Anti-DFFA Antibody 25ul