SDR16C5,RDH-E2,RDHE2
  • SDR16C5,RDH-E2,RDHE2

Anti-SDR16C5 Antibody 25ul

Ref: AN-HPA025224-25ul
Anti-SDR16C5

Información del producto

Polyclonal Antibody against Human SDR16C5, Gene description: short chain dehydrogenase/reductase family 16C, member 5, Alternative Gene Names: RDH-E2, RDHE2, Validated applications: IHC, WB, Uniprot ID: Q8N3Y7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SDR16C5
Gene Description short chain dehydrogenase/reductase family 16C, member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL
Immunogen CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RDH-E2, RDHE2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N3Y7
HTS Code 3002150000
Gene ID 195814
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SDR16C5 Antibody 25ul

Anti-SDR16C5 Antibody 25ul