XKR4,KIAA1889
  • XKR4,KIAA1889

Anti-XKR4 Antibody 100ul

Ref: AN-HPA025072-100ul
Anti-XKR4

Información del producto

Polyclonal Antibody against Human XKR4, Gene description: XK, Kell blood group complex subunit-related family, member 4, Alternative Gene Names: KIAA1889, Validated applications: IHC, Uniprot ID: Q5GH76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name XKR4
Gene Description XK, Kell blood group complex subunit-related family, member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS
Immunogen FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1889
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5GH76
HTS Code 3002150000
Gene ID 114786
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-XKR4 Antibody 100ul

Anti-XKR4 Antibody 100ul