PHF20L1,CGI-72
  • PHF20L1,CGI-72

Anti-PHF20L1 Antibody 100ul

Ref: AN-HPA025060-100ul
Anti-PHF20L1

Información del producto

Polyclonal Antibody against Human PHF20L1, Gene description: PHD finger protein 20-like 1, Alternative Gene Names: CGI-72, FLJ13649, FLJ21615, MGC64923, TDRD20B, Validated applications: IHC, Uniprot ID: A8MW92, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PHF20L1
Gene Description PHD finger protein 20-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLP
Immunogen LLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-72, FLJ13649, FLJ21615, MGC64923, TDRD20B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A8MW92
HTS Code 3002150000
Gene ID 51105
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PHF20L1 Antibody 100ul

Anti-PHF20L1 Antibody 100ul