RABEP1,neurocrescin
  • RABEP1,neurocrescin

Anti-RABEP1 Antibody 25ul

Ref: AN-HPA024691-25ul
Anti-RABEP1

Información del producto

Polyclonal Antibody against Human RABEP1, Gene description: rabaptin, RAB GTPase binding effector protein 1, Alternative Gene Names: neurocrescin, RAB5EP, rabaptin-5, RABPT5, Validated applications: IHC, WB, Uniprot ID: Q15276, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RABEP1
Gene Description rabaptin, RAB GTPase binding effector protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLS
Immunogen VHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names neurocrescin, RAB5EP, rabaptin-5, RABPT5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15276
HTS Code 3002150000
Gene ID 9135
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RABEP1 Antibody 25ul

Anti-RABEP1 Antibody 25ul