SNTB1,59-DAP,A1B
  • SNTB1,59-DAP,A1B

Anti-SNTB1 Antibody 25ul

Ref: AN-HPA024659-25ul
Anti-SNTB1

Información del producto

Polyclonal Antibody against Human SNTB1, Gene description: syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1), Alternative Gene Names: 59-DAP, A1B, BSYN2, SNT2, SNT2B1, TIP-43, Validated applications: IHC, Uniprot ID: Q13884, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNTB1
Gene Description syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
Immunogen QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 59-DAP, A1B, BSYN2, SNT2, SNT2B1, TIP-43
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13884
HTS Code 3002150000
Gene ID 6641
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNTB1 Antibody 25ul

Anti-SNTB1 Antibody 25ul