MARK3,CTAK1,KP78
  • MARK3,CTAK1,KP78

Anti-MARK3 Antibody 100ul

Ref: AN-HPA024652-100ul
Anti-MARK3

Información del producto

Polyclonal Antibody against Human MARK3, Gene description: MAP/microtubule affinity-regulating kinase 3, Alternative Gene Names: CTAK1, KP78, PAR-1A, Validated applications: IHC, WB, Uniprot ID: P27448, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MARK3
Gene Description MAP/microtubule affinity-regulating kinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAA
Immunogen QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CTAK1, KP78, PAR-1A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P27448
HTS Code 3002150000
Gene ID 4140
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MARK3 Antibody 100ul

Anti-MARK3 Antibody 100ul