RRP15,CGI-115
  • RRP15,CGI-115

Anti-RRP15 Antibody 100ul

Ref: AN-HPA024639-100ul
Anti-RRP15

Información del producto

Polyclonal Antibody against Human RRP15, Gene description: ribosomal RNA processing 15 homolog (S. cerevisiae), Alternative Gene Names: CGI-115, KIAA0507, Validated applications: ICC, IHC, Uniprot ID: Q9Y3B9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RRP15
Gene Description ribosomal RNA processing 15 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Immunogen VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-115, KIAA0507
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3B9
HTS Code 3002150000
Gene ID 51018
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RRP15 Antibody 100ul

Anti-RRP15 Antibody 100ul