TARBP1,TRM3,TRP-185
  • TARBP1,TRM3,TRP-185

Anti-TARBP1 Antibody 100ul

Ref: AN-HPA024632-100ul
Anti-TARBP1

Información del producto

Polyclonal Antibody against Human TARBP1, Gene description: TAR (HIV-1) RNA binding protein 1, Alternative Gene Names: TRM3, TRP-185, Validated applications: ICC, IHC, Uniprot ID: Q13395, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TARBP1
Gene Description TAR (HIV-1) RNA binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG
Immunogen MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TRM3, TRP-185
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13395
HTS Code 3002150000
Gene ID 6894
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TARBP1 Antibody 100ul

Anti-TARBP1 Antibody 100ul