NEDD4L,KIAA0439
  • NEDD4L,KIAA0439

Anti-NEDD4L Antibody 25ul

Ref: AN-HPA024618-25ul
Anti-NEDD4L

Información del producto

Polyclonal Antibody against Human NEDD4L, Gene description: neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase, Alternative Gene Names: KIAA0439, NEDD4-2, RSP5, Validated applications: IHC, Uniprot ID: Q96PU5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NEDD4L
Gene Description neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM
Immunogen SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0439, NEDD4-2, RSP5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PU5
HTS Code 3002150000
Gene ID 23327
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NEDD4L Antibody 25ul

Anti-NEDD4L Antibody 25ul