PWP2,EHOC-17,PWP2H
  • PWP2,EHOC-17,PWP2H

Anti-PWP2 Antibody 100ul

Ref: AN-HPA024573-100ul
Anti-PWP2

Información del producto

Polyclonal Antibody against Human PWP2, Gene description: PWP2 periodic tryptophan protein homolog (yeast), Alternative Gene Names: EHOC-17, PWP2H, UTP1, Validated applications: ICC, IHC, WB, Uniprot ID: Q15269, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PWP2
Gene Description PWP2 periodic tryptophan protein homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYSLDTRVLFDPFELDTSVTPGRVREALRQQDFTRAIL
Immunogen AGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYSLDTRVLFDPFELDTSVTPGRVREALRQQDFTRAIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EHOC-17, PWP2H, UTP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15269
HTS Code 3002150000
Gene ID 5822
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PWP2 Antibody 100ul

Anti-PWP2 Antibody 100ul