FAM213A,C10orf58
  • FAM213A,C10orf58

Anti-FAM213A Antibody 100ul

Ref: AN-HPA024565-100ul
Anti-FAM213A

Información del producto

Polyclonal Antibody against Human FAM213A, Gene description: family with sequence similarity 213, member A, Alternative Gene Names: C10orf58, MGC4248, PAMM, Validated applications: IHC, WB, Uniprot ID: Q9BRX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM213A
Gene Description family with sequence similarity 213, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications IHC, WB
Sequence KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
Immunogen KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf58, MGC4248, PAMM
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRX8
HTS Code 3002150000
Gene ID 84293
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM213A Antibody 100ul

Anti-FAM213A Antibody 100ul