CERS3,LASS3,MGC27091
  • CERS3,LASS3,MGC27091

Anti-CERS3 Antibody 25ul

Ref: AN-HPA024356-25ul
Anti-CERS3

Información del producto

Polyclonal Antibody against Human CERS3, Gene description: ceramide synthase 3, Alternative Gene Names: LASS3, MGC27091, Validated applications: IHC, WB, Uniprot ID: Q8IU89, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CERS3
Gene Description ceramide synthase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH
Immunogen NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LASS3, MGC27091
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IU89
HTS Code 3002150000
Gene ID 204219
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CERS3 Antibody 25ul

Anti-CERS3 Antibody 25ul