KRT20,CK20,K20
  • KRT20,CK20,K20

Anti-KRT20 Antibody 25ul

Ref: AN-HPA024309-25ul
Anti-KRT20

Información del producto

Polyclonal Antibody against Human KRT20, Gene description: keratin 20, Alternative Gene Names: CK20, K20, MGC35423, Validated applications: IHC, WB, Uniprot ID: P35900, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KRT20
Gene Description keratin 20
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Immunogen MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CK20, K20, MGC35423
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35900
HTS Code 3002150000
Gene ID 54474
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KRT20 Antibody 25ul

Anti-KRT20 Antibody 25ul