B3GNT3,B3GN-T3
  • B3GNT3,B3GN-T3

Anti-B3GNT3 Antibody 25ul

Ref: AN-HPA024298-25ul
Anti-B3GNT3

Información del producto

Polyclonal Antibody against Human B3GNT3, Gene description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, Alternative Gene Names: B3GN-T3, B3GNT-3, beta3Gn-T3, HP10328, TMEM3, Validated applications: IHC, Uniprot ID: Q9Y2A9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B3GNT3
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
Immunogen LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B3GN-T3, B3GNT-3, beta3Gn-T3, HP10328, TMEM3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2A9
HTS Code 3002150000
Gene ID 10331
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B3GNT3 Antibody 25ul

Anti-B3GNT3 Antibody 25ul