OR2K2,HSHTPCRH06
  • OR2K2,HSHTPCRH06

Anti-OR2K2 Antibody 100ul

Ref: AN-HPA024261-100ul
Anti-OR2K2

Información del producto

Polyclonal Antibody against Human OR2K2, Gene description: olfactory receptor, family 2, subfamily K, member 2, Alternative Gene Names: HSHTPCRH06, HTPCRH06, OR2AR1P, Validated applications: IHC, Uniprot ID: Q8NGT1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OR2K2
Gene Description olfactory receptor, family 2, subfamily K, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEV
Immunogen TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSHTPCRH06, HTPCRH06, OR2AR1P
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NGT1
HTS Code 3002150000
Gene ID 26248
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OR2K2 Antibody 100ul

Anti-OR2K2 Antibody 100ul