SZRD1,C1orf144
  • SZRD1,C1orf144

Anti-SZRD1 Antibody 25ul

Ref: AN-HPA024221-25ul
Anti-SZRD1

Información del producto

Polyclonal Antibody against Human SZRD1, Gene description: SUZ RNA binding domain containing 1, Alternative Gene Names: C1orf144, DKFZp566C0424, Validated applications: ICC, IHC, WB, Uniprot ID: Q7Z422, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SZRD1
Gene Description SUZ RNA binding domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQR
Immunogen PNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf144, DKFZp566C0424
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z422
HTS Code 3002150000
Gene ID 26099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SZRD1 Antibody 25ul

Anti-SZRD1 Antibody 25ul