EIF2B3,EIF-2B
  • EIF2B3,EIF-2B

Anti-EIF2B3 Antibody 100ul

Ref: AN-HPA024219-100ul
Anti-EIF2B3

Información del producto

Polyclonal Antibody against Human EIF2B3, Gene description: eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa, Alternative Gene Names: EIF-2B, EIF2Bgamma, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NR50, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF2B3
Gene Description eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVG
Immunogen KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIF-2B, EIF2Bgamma
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NR50
HTS Code 3002150000
Gene ID 8891
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF2B3 Antibody 100ul

Anti-EIF2B3 Antibody 100ul