TRIM41,MGC1127,RINCK
  • TRIM41,MGC1127,RINCK

Anti-TRIM41 Antibody 25ul

Ref: AN-HPA024204-25ul
Anti-TRIM41

Información del producto

Polyclonal Antibody against Human TRIM41, Gene description: tripartite motif containing 41, Alternative Gene Names: MGC1127, RINCK, Validated applications: ICC, IHC, Uniprot ID: Q8WV44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRIM41
Gene Description tripartite motif containing 41
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA
Immunogen RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC1127, RINCK
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WV44
HTS Code 3002150000
Gene ID 90933
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRIM41 Antibody 25ul

Anti-TRIM41 Antibody 25ul