RBCK1,C20orf18
  • RBCK1,C20orf18

Anti-RBCK1 Antibody 25ul

Ref: AN-HPA024185-25ul
Anti-RBCK1

Información del producto

Polyclonal Antibody against Human RBCK1, Gene description: RanBP-type and C3HC4-type zinc finger containing 1, Alternative Gene Names: C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4, Validated applications: WB, Uniprot ID: Q9BYM8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBCK1
Gene Description RanBP-type and C3HC4-type zinc finger containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Immunogen SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYM8
HTS Code 3002150000
Gene ID 10616
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBCK1 Antibody 25ul

Anti-RBCK1 Antibody 25ul