PXK,FLJ20335
  • PXK,FLJ20335

Anti-PXK Antibody 100ul

Ref: AN-HPA024068-100ul
Anti-PXK

Información del producto

Polyclonal Antibody against Human PXK, Gene description: PX domain containing serine/threonine kinase, Alternative Gene Names: FLJ20335, Validated applications: ICC, IHC, WB, Uniprot ID: Q7Z7A4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PXK
Gene Description PX domain containing serine/threonine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence LSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLP
Immunogen LSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20335
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7A4
HTS Code 3002150000
Gene ID 54899
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PXK Antibody 100ul

Anti-PXK Antibody 100ul