HPGDS,GSTS,GSTS1-1
  • HPGDS,GSTS,GSTS1-1

Anti-HPGDS Antibody 100ul

Ref: AN-HPA024035-100ul
Anti-HPGDS

Información del producto

Polyclonal Antibody against Human HPGDS, Gene description: hematopoietic prostaglandin D synthase, Alternative Gene Names: GSTS, GSTS1-1, H-PGDS, PGD2, PGDS, Validated applications: IHC, Uniprot ID: O60760, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HPGDS
Gene Description hematopoietic prostaglandin D synthase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
Immunogen KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GSTS, GSTS1-1, H-PGDS, PGD2, PGDS
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60760
HTS Code 3002150000
Gene ID 27306
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HPGDS Antibody 100ul

Anti-HPGDS Antibody 100ul