CEP131,AZ1,AZI1
  • CEP131,AZ1,AZI1

Anti-CEP131 Antibody 100ul

Ref: AN-HPA024019-100ul
Anti-CEP131

Información del producto

Polyclonal Antibody against Human CEP131, Gene description: centrosomal protein 131kDa, Alternative Gene Names: AZ1, AZI1, KIAA1118, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UPN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CEP131
Gene Description centrosomal protein 131kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Immunogen DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AZ1, AZI1, KIAA1118
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPN4
HTS Code 3002150000
Gene ID 22994
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CEP131 Antibody 100ul

Anti-CEP131 Antibody 100ul