RAB11FIP1,FLJ22524
  • RAB11FIP1,FLJ22524

Anti-RAB11FIP1 Antibody 100ul

Ref: AN-HPA024010-100ul
Anti-RAB11FIP1

Información del producto

Polyclonal Antibody against Human RAB11FIP1, Gene description: RAB11 family interacting protein 1 (class I), Alternative Gene Names: FLJ22524, FLJ22622, Rab11-FIP1, RCP, Validated applications: ICC, IHC, Uniprot ID: Q6WKZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB11FIP1
Gene Description RAB11 family interacting protein 1 (class I)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSEQLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
Immunogen ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSEQLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22524, FLJ22622, Rab11-FIP1, RCP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6WKZ4
HTS Code 3002150000
Gene ID 80223
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAB11FIP1 Antibody 100ul

Anti-RAB11FIP1 Antibody 100ul