NBR1,1A1-3B,CA125
  • NBR1,1A1-3B,CA125

Anti-NBR1 Antibody 100ul

Ref: AN-HPA023999-100ul
Anti-NBR1

Información del producto

Polyclonal Antibody against Human NBR1, Gene description: neighbor of BRCA1 gene 1, Alternative Gene Names: 1A1-3B, CA125, KIAA0049, M17S2, Validated applications: IHC, Uniprot ID: Q14596, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NBR1
Gene Description neighbor of BRCA1 gene 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHS
Immunogen KLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 1A1-3B, CA125, KIAA0049, M17S2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14596
HTS Code 3002150000
Gene ID 4077
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NBR1 Antibody 100ul

Anti-NBR1 Antibody 100ul