RTN4,ASY,KIAA0886
  • RTN4,ASY,KIAA0886

Anti-RTN4 Antibody 25ul

Ref: AN-HPA023977-25ul
Anti-RTN4

Información del producto

Polyclonal Antibody against Human RTN4, Gene description: reticulon 4, Alternative Gene Names: ASY, KIAA0886, NOGO, NSP-CL, Validated applications: ICC, IHC, Uniprot ID: Q9NQC3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RTN4
Gene Description reticulon 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLS
Immunogen ETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ASY, KIAA0886, NOGO, NSP-CL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQC3
HTS Code 3002150000
Gene ID 57142
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RTN4 Antibody 25ul

Anti-RTN4 Antibody 25ul