TRMT12,FLJ20772
  • TRMT12,FLJ20772

Anti-TRMT12 Antibody 25ul

Ref: AN-HPA023939-25ul
Anti-TRMT12

Información del producto

Polyclonal Antibody against Human TRMT12, Gene description: tRNA methyltransferase 12 homolog (S. cerevisiae), Alternative Gene Names: FLJ20772, Trm12, TYW2, Validated applications: ICC, IHC, WB, Uniprot ID: Q53H54, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRMT12
Gene Description tRNA methyltransferase 12 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE
Immunogen WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20772, Trm12, TYW2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53H54
HTS Code 3002150000
Gene ID 55039
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRMT12 Antibody 25ul

Anti-TRMT12 Antibody 25ul