TMEM245,C9orf5,CG-2
  • TMEM245,C9orf5,CG-2

Anti-TMEM245 Antibody 100ul

Ref: AN-HPA023892-100ul
Anti-TMEM245

Información del producto

Polyclonal Antibody against Human TMEM245, Gene description: transmembrane protein 245, Alternative Gene Names: C9orf5, CG-2, Validated applications: ICC, IHC, Uniprot ID: Q9H330, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM245
Gene Description transmembrane protein 245
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AELPGQVISMAASTLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK
Immunogen AELPGQVISMAASTLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf5, CG-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H330
HTS Code 3002150000
Gene ID 23731
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMEM245 Antibody 100ul

Anti-TMEM245 Antibody 100ul