MYO1E,HuncM-IC
  • MYO1E,HuncM-IC

Anti-MYO1E Antibody 25ul

Ref: AN-HPA023886-25ul
Anti-MYO1E

Información del producto

Polyclonal Antibody against Human MYO1E, Gene description: myosin IE, Alternative Gene Names: HuncM-IC, MGC104638, MYO1C, Validated applications: IHC, WB, Uniprot ID: Q12965, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MYO1E
Gene Description myosin IE
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQG
Immunogen VIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HuncM-IC, MGC104638, MYO1C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12965
HTS Code 3002150000
Gene ID 4643
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MYO1E Antibody 25ul

Anti-MYO1E Antibody 25ul