ARID5A,MRF-1
  • ARID5A,MRF-1

Anti-ARID5A Antibody 25ul

Ref: AN-HPA023879-25ul
Anti-ARID5A

Información del producto

Polyclonal Antibody against Human ARID5A, Gene description: AT rich interactive domain 5A (MRF1-like), Alternative Gene Names: MRF-1, RP11-363D14, Validated applications: ICC, IHC, WB, Uniprot ID: Q03989, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARID5A
Gene Description AT rich interactive domain 5A (MRF1-like)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH
Immunogen LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MRF-1, RP11-363D14
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q03989
HTS Code 3002150000
Gene ID 10865
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARID5A Antibody 25ul

Anti-ARID5A Antibody 25ul