CHMP4C,MGC22825
  • CHMP4C,MGC22825

Anti-CHMP4C Antibody 100ul

Ref: AN-HPA023799-100ul
Anti-CHMP4C

Información del producto

Polyclonal Antibody against Human CHMP4C, Gene description: charged multivesicular body protein 4C, Alternative Gene Names: MGC22825, Shax3, VPS32C, Validated applications: IHC, Uniprot ID: Q96CF2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHMP4C
Gene Description charged multivesicular body protein 4C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Immunogen MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC22825, Shax3, VPS32C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96CF2
HTS Code 3002150000
Gene ID 92421
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CHMP4C Antibody 100ul

Anti-CHMP4C Antibody 100ul