CDC14A,cdc14
  • CDC14A,cdc14

Anti-CDC14A Antibody 25ul

Ref: AN-HPA023783-25ul
Anti-CDC14A

Información del producto

Polyclonal Antibody against Human CDC14A, Gene description: cell division cycle 14A, Alternative Gene Names: cdc14, Cdc14A1, Cdc14A2, Validated applications: ICC, IHC, Uniprot ID: Q9UNH5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDC14A
Gene Description cell division cycle 14A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL
Immunogen QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cdc14, Cdc14A1, Cdc14A2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNH5
HTS Code 3002150000
Gene ID 8556
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDC14A Antibody 25ul

Anti-CDC14A Antibody 25ul