TRIM58,BIA2
  • TRIM58,BIA2

Anti-TRIM58 Antibody 100ul

Ref: AN-HPA023637-100ul
Anti-TRIM58

Información del producto

Polyclonal Antibody against Human TRIM58, Gene description: tripartite motif containing 58, Alternative Gene Names: BIA2, Validated applications: WB, Uniprot ID: Q8NG06, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TRIM58
Gene Description tripartite motif containing 58
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence EAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL
Immunogen EAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BIA2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NG06
HTS Code 3002150000
Gene ID 25893
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRIM58 Antibody 100ul

Anti-TRIM58 Antibody 100ul