CDH17,cadherin,HPT-1
  • CDH17,cadherin,HPT-1

Anti-CDH17 Antibody 100ul

Ref: AN-HPA023616-100ul
Anti-CDH17

Información del producto

Polyclonal Antibody against Human CDH17, Gene description: cadherin 17, LI cadherin (liver-intestine), Alternative Gene Names: cadherin, HPT-1, Validated applications: IHC, WB, Uniprot ID: Q12864, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDH17
Gene Description cadherin 17, LI cadherin (liver-intestine)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK
Immunogen HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cadherin, HPT-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12864
HTS Code 3002150000
Gene ID 1015
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDH17 Antibody 100ul

Anti-CDH17 Antibody 100ul