C17orf97,LOC400566
  • C17orf97,LOC400566

Anti-C17orf97 Antibody 25ul

Ref: AN-HPA023583-25ul
Anti-C17orf97

Información del producto

Polyclonal Antibody against Human C17orf97, Gene description: chromosome 17 open reading frame 97, Alternative Gene Names: LOC400566, Validated applications: ICC, IHC, Uniprot ID: Q6ZQX7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C17orf97
Gene Description chromosome 17 open reading frame 97
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP
Immunogen SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LOC400566
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZQX7
HTS Code 3002150000
Gene ID 400566
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C17orf97 Antibody 25ul

Anti-C17orf97 Antibody 25ul