PHF21A,BHC80,BM-006
  • PHF21A,BHC80,BM-006

Anti-PHF21A Antibody 100ul

Ref: AN-HPA023580-100ul
Anti-PHF21A

Información del producto

Polyclonal Antibody against Human PHF21A, Gene description: PHD finger protein 21A, Alternative Gene Names: BHC80, BM-006, KIAA1696, Validated applications: IHC, Uniprot ID: Q96BD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PHF21A
Gene Description PHD finger protein 21A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQG
Immunogen QEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BHC80, BM-006, KIAA1696
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BD5
HTS Code 3002150000
Gene ID 51317
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PHF21A Antibody 100ul

Anti-PHF21A Antibody 100ul