EIF4EBP1,4E-BP1
  • EIF4EBP1,4E-BP1

Anti-EIF4EBP1 Antibody 100ul

Ref: AN-HPA023501-100ul
Anti-EIF4EBP1

Información del producto

Polyclonal Antibody against Human EIF4EBP1, Gene description: eukaryotic translation initiation factor 4E binding protein 1, Alternative Gene Names: 4E-BP1, PHAS-I, Validated applications: IHC, WB, Uniprot ID: Q13541, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF4EBP1
Gene Description eukaryotic translation initiation factor 4E binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Immunogen PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4E-BP1, PHAS-I
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13541
HTS Code 3002150000
Gene ID 1978
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF4EBP1 Antibody 100ul

Anti-EIF4EBP1 Antibody 100ul