ZNF347,ZNF1111
  • ZNF347,ZNF1111

Anti-ZNF347 Antibody 100ul

Ref: AN-HPA023448-100ul
Anti-ZNF347

Información del producto

Polyclonal Antibody against Human ZNF347, Gene description: zinc finger protein 347, Alternative Gene Names: ZNF1111, Validated applications: ICC, IHC, Uniprot ID: Q96SE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF347
Gene Description zinc finger protein 347
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LGISCFDLSIISMLEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVM
Immunogen LGISCFDLSIISMLEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZNF1111
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96SE7
HTS Code 3002150000
Gene ID 84671
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF347 Antibody 100ul

Anti-ZNF347 Antibody 100ul