ATP6V1H,CGI-11,SFD
  • ATP6V1H,CGI-11,SFD

Anti-ATP6V1H Antibody 25ul

Ref: AN-HPA023421-25ul
Anti-ATP6V1H

Información del producto

Polyclonal Antibody against Human ATP6V1H, Gene description: ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, Alternative Gene Names: CGI-11, SFD, SFDalpha, SFDbeta, VMA13, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UI12, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ATP6V1H
Gene Description ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Immunogen PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-11, SFD, SFDalpha, SFDbeta, VMA13
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UI12
HTS Code 3002150000
Gene ID 51606
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ATP6V1H Antibody 25ul

Anti-ATP6V1H Antibody 25ul