TSTA3,FX,P35B,SDR4E1
  • TSTA3,FX,P35B,SDR4E1

Anti-TSTA3 Antibody 100ul

Ref: AN-HPA023361-100ul
Anti-TSTA3

Información del producto

Polyclonal Antibody against Human TSTA3, Gene description: tissue specific transplantation antigen P35B, Alternative Gene Names: FX, P35B, SDR4E1, Validated applications: ICC, IHC, WB, Uniprot ID: Q13630, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSTA3
Gene Description tissue specific transplantation antigen P35B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG
Immunogen RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FX, P35B, SDR4E1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13630
HTS Code 3002150000
Gene ID 7264
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSTA3 Antibody 100ul

Anti-TSTA3 Antibody 100ul