GRPEL2,DKFZp451C205
  • GRPEL2,DKFZp451C205

Anti-GRPEL2 Antibody 25ul

Ref: AN-HPA023211-25ul
Anti-GRPEL2

Información del producto

Polyclonal Antibody against Human GRPEL2, Gene description: GrpE-like 2, mitochondrial (E. coli), Alternative Gene Names: DKFZp451C205, FLJ23713, Mt-GrpE#2, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TAA5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GRPEL2
Gene Description GrpE-like 2, mitochondrial (E. coli)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, ICC, IHC
Sequence VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVE
Immunogen VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp451C205, FLJ23713, Mt-GrpE#2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAA5
HTS Code 3002150000
Gene ID 134266
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GRPEL2 Antibody 25ul

Anti-GRPEL2 Antibody 25ul